Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Protein-tyrosine sulfotransferase 2(Tpst2)

Recombinant Mouse Protein-tyrosine sulfotransferase 2(Tpst2)

SKU:CSB-CF024133MO

Regular price £1,445.00 GBP
Regular price Sale price £1,445.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O88856

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLSVRKVLLAAGCALALVLAVQLGQQVLECRAVLGGTRNPRRMRPEQEELVMLGADHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWTKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLARLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGRDKCLPVYYEQLVLHPRRSLKRILDFLGIAWSDTVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPRDVVRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLKGYFQVNQNSTSPHLGSS

Protein Names:Recommended name: Protein-tyrosine sulfotransferase 2 EC= 2.8.2.20 Alternative name(s): Tyrosylprotein sulfotransferase 2 Short name= TPST-2

Gene Names:Name:Tpst2 Synonyms:D5ucla3

Expression Region:1-376

Sequence Info:full length protein

View full details