Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Protein TRIQK(Triqk)

Recombinant Mouse Protein TRIQK(Triqk)

SKU:CSB-CF004255MO

Regular price £1,166.00 GBP
Regular price Sale price £1,166.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:B2B9E1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGRKDSSNTKLPVDQYRKQIGKQDYKKTKPILRATKLKAEAKKTAIGIKEVGLMLAAILA LLLAFYAFFYLRLSTNIDSDLDLDED

Protein Names:Recommended name: Protein TRIQK Alternative name(s): Triple repetitive-sequence of QXXK/R protein homolog

Gene Names:Name:Triqk Synonyms:Gm11818

Expression Region:1-86

Sequence Info:full length protein

View full details