Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Protein FAM19A5(Fam19a5)

Recombinant Mouse Protein FAM19A5(Fam19a5)

SKU:CSB-CF838684MO

Regular price £1,209.00 GBP
Regular price Sale price £1,209.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q91WE9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPSPRTSSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT IARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCT QPGGRIKTTTVS

Protein Names:Recommended name: Protein FAM19A5 Alternative name(s): Chemokine-like protein TAFA-5

Gene Names:Name:Fam19a5 Synonyms:Tafa5

Expression Region:1-132

Sequence Info:full length protein

View full details