Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Protein FAM162A(Fam162a)

Recombinant Mouse Protein FAM162A(Fam162a)

SKU:CSB-CF880508MO

Regular price £1,228.00 GBP
Regular price Sale price £1,228.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9D6U8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWSLGGLRLAAGHCLRLYERNASSSLRFTRNTDLKRINGFCTKPQESPKTPTQSYRHGVP LHKPTDFEKKILLWSGRFKKEEEIPETISFEMLDAAKNKLRVKVSYLMIALTVAGCIYMV IEGKKAAKRHESLTSLNLERKARLREEAAMKAKTD

Protein Names:Recommended name: Protein FAM162A Alternative name(s): E2-induced gene 5 protein homolog

Gene Names:Name:Fam162a Synonyms:E2ig5

Expression Region:1-155

Sequence Info:full length protein

View full details