Gene Bio Systems
Recombinant Mouse Protein FAM162A(Fam162a)
Recombinant Mouse Protein FAM162A(Fam162a)
SKU:CSB-CF880508MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9D6U8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWSLGGLRLAAGHCLRLYERNASSSLRFTRNTDLKRINGFCTKPQESPKTPTQSYRHGVP LHKPTDFEKKILLWSGRFKKEEEIPETISFEMLDAAKNKLRVKVSYLMIALTVAGCIYMV IEGKKAAKRHESLTSLNLERKARLREEAAMKAKTD
Protein Names:Recommended name: Protein FAM162A Alternative name(s): E2-induced gene 5 protein homolog
Gene Names:Name:Fam162a Synonyms:E2ig5
Expression Region:1-155
Sequence Info:full length protein
