Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Probable N-acetyltransferase 8B(Nat8b)

Recombinant Mouse Probable N-acetyltransferase 8B(Nat8b)

SKU:CSB-CF015475MO

Regular price £1,294.00 GBP
Regular price Sale price £1,294.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:E0CYC6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPRFEAQKSSMVPYHIRQYQDSDHKRVVDVFTTGAEEYIPSTFRHVLRLPRTFLLLLGVP LALVLVSGSWILAVICIFFLLLLLRLLARQPWKEYVAKCLQTYMVDITKSYLNVHGACFW VAESGGQVVGIVAAQPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQFARDQSY SDVVLETSTLQQGAMTLYLGMGFKKTGQYFKSMFWRLVDICFIQLNYSFPSA

Protein Names:Recommended name: Probable N-acetyltransferase 8B EC= 2.3.1.- Alternative name(s): Camello-like protein 2

Gene Names:Name:Nat8b Synonyms:Cml2

Expression Region:1-232

Sequence Info:full length protein

View full details