Gene Bio Systems
Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP11(Fkbp11)
Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP11(Fkbp11)
SKU:CSB-CF887499MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q9D1M7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GPETESPVRTLQVETLVQPPESCTESAAIGDTLHIHYTGSLVDGRIIDTSLTRDPLVIEL GQKQVIPGLEQSLLDMCVGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVELIALIRAN YWQKLLKSILPLVGIAMVPALLGLIGYHLYRKASRPKVSKKKLKEEKRNKSKKK
Protein Names:Recommended name: Peptidyl-prolyl cis-trans isomerase FKBP11 Short name= PPIase FKBP11 EC= 5.2.1.8 Alternative name(s): 19 kDa FK506-binding protein Short name= 19 kDa FKBP Short name= FKBP-19 FK506-binding protein
Gene Names:Name:Fkbp11
Expression Region:28-201
Sequence Info:full length protein
