Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse p53 apoptosis effector related to PMP-22(Perp)

Recombinant Mouse p53 apoptosis effector related to PMP-22(Perp)

SKU:CSB-CF872865MO

Regular price £1,260.00 GBP
Regular price Sale price £1,260.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9JK95

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSNHIQTSSLWWRCFDEGGGSGS YDDGCQSLMEYAWGRAAAATLFCGFIILCICFILSFFALCGPQMLVFLRVIGGLLALAAI FQIISLVIYPVKYTQTFRLHDNPAVNYIYNWAYGFGWAATIILIGCSFFFCCLPNYEDDL LGAAKPRYFYPPA

Protein Names:Recommended name: p53 apoptosis effector related to PMP-22 Alternative name(s): Keratinocyte-associated protein 1 Short name= KCP-1

Gene Names:Name:Perp Synonyms:Krtcap1

Expression Region:1-193

Sequence Info:full length protein

View full details