Recombinant Mouse Osteocalcin(Bglap)

SKU: CSB-EP002682MO

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P86546

Gene Names: Bglap

Organism: Mus musculus (Mouse)

AA Sequence: YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI

Expression Region: 50-95aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 21.1 kDa

Alternative Name(s): Bone Gla protein Short name: BGP Gamma-carboxyglutamic acid-containing protein

Relevance: Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.

Reference: "The mouse osteocalcin gene cluster contains three genes with two separate spatial and temporal patterns of expression."Desbois C., Hogue D.A., Karsenty G.J. Biol. Chem. 269:1183-1190(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.