Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Neurensin-1(Nrsn1)

Recombinant Mouse Neurensin-1(Nrsn1)

SKU:CSB-CF016093MO

Regular price £1,263.00 GBP
Regular price Sale price £1,263.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P97799

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSCSNTCGSRRAQADTEGGYQQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSS VFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFMVVDTHAVKYNGALDTCKLAG AVLFCIGGTSMAGCLLMSVFAKSYSKEEKFLQQKFKERIADIKAHTQPITKAPGPGDTKI PVTLSRVQNVQPLSAT

Protein Names:Recommended name: Neurensin-1 Alternative name(s): Neuro-p24 Vesicular membrane protein of 24 kDa Short name= Vesicular membrane protein p24

Gene Names:Name:Nrsn1 Synonyms:Vmp

Expression Region:1-196

Sequence Info:Full length protein

View full details