Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Neural retina-specific leucine zipper protein(Nrl)

Recombinant Mouse Neural retina-specific leucine zipper protein(Nrl)

SKU:CSB-EP016086MO

Regular price £870.00 GBP
Regular price Sale price £870.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P54846

Gene Names:Nrl

Organism:Mus musculus (Mouse)

AA Sequence:MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL

Expression Region:1-237aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW:46.1 kDa

Alternative Name(s):Nrl; Neural retina-specific leucine zipper protein; NRL

Relevance:Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.

Reference:"Sumoylation of bZIP transcription factor NRL modulates target gene expression during photoreceptor differentiation." Roger J.E., Nellissery J., Kim D.S., Swaroop A. J. Biol. Chem. 285:25637-25644(2010)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.

Involvement in disease:

Subcellular Location:Cytoplasm, Nucleus

Protein Families:BZIP family

Tissue Specificity:Expressed in the retina (at protein level) (PubMed:11477108).

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=20422

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:18185

STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000054457

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details