Gene Bio Systems
Recombinant Mouse Natural killer cells antigen CD94(Klrd1)
Recombinant Mouse Natural killer cells antigen CD94(Klrd1)
SKU:CSB-CF012470MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:O54707
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQCNCYFISKEEKSWKRSRDFCASQNSSLLQPQSRNELSFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDLFPEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI
Protein Names:Recommended name: Natural killer cells antigen CD94 Alternative name(s): Killer cell lectin-like receptor subfamily D member 1 CD_antigen= CD94
Gene Names:Name:Klrd1 Synonyms:Cd94
Expression Region:1-179
Sequence Info:full length protein
