Recombinant Mouse Myelin-oligodendrocyte glycoprotein (Mog), partial

SKU: Q61885

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Neuroscience

Uniprot ID: Q61885

Gene Names: Mog

Alternative Name(s):

Abbreviation: Recombinant Mouse Mog protein, partial

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 29-156aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

MW: 20.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. Mediates homophilic cell-cell adhesion.

Reference: "The crystal structure of myelin oligodendrocyte glycoprotein, a key autoantigen in multiple sclerosis." Clements C.S., Reid H.H., Beddoe T., Tynan F.E., Perugini M.A., Johns T.G., Bernard C.C., Rossjohn J. Proc. Natl. Acad. Sci. U.S.A. 100: 11059-11064(2003)

Function: