Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Myc target protein 1(Myct1)

Recombinant Mouse Myc target protein 1(Myct1)

SKU:CSB-CF848123MO

Regular price £1,255.00 GBP
Regular price Sale price £1,255.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8R411

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MANNTTSLGSPWPENFWEDLIMSFTVSVAIGLAIGGFLWALFVFLSRRRRASAPISQWSP TRRPRSSYNHGLNRTGFYRHSGYERRSNLSLASLTFQRQASMELVNSFPRKSSFRASTFH PFLQCPPLPVETESQLMTLSASTTPSTLSTAHSPSRPDFRWSSNSLRMGLSTPPPPAYES IIKAFPDS

Protein Names:Recommended name: Myc target protein 1 Alternative name(s): Myc target in myeloid cells protein 1

Gene Names:Name:Myct1 Synonyms:Mtmc1

Expression Region:1-188

Sequence Info:full length protein

View full details