Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Mucin 5, subtypes A and C, tracheobronchial/gastric (Muc5ac), partial

Recombinant Mouse Mucin 5, subtypes A and C, tracheobronchial/gastric (Muc5ac), partial

SKU:E9PWB6

Regular price £583.00 GBP
Regular price Sale price £583.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: E9PWB6

Gene Names: Muc5ac

Alternative Name(s): /

Abbreviation: Recombinant Mouse Muc5ac protein, partial

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 2452-2721aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: CPKNSSLIVTYEEGACCPTQNCSSQKGCEVNGTLYQPGDVVSSSLCERCLCEVSSNPLSDVFMVSCETELCNTQCPKGSEYQAMPGQCCGKCIPKTCPFKNNSGSTYFYQPGELWAEPGNPCVTHKCEKFQDVLMVVTMKTECPKINCPQGQAQLREDGCCYDCPLPNQQKCTVHQRQQIIRQQNCSSEGPVSISYCQGNCGDSISMYSLEANKVEHTCECCQELQTSQRNVTLRCDDGSSQTFSYTQVEKCGCLGQQCHALGDTSHAES

MW: 33.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Gel-forming glycoprotein of gastric and respiratoy tract epithelia that protects the mucosa from infection and chical damage by binding to inhaled microrganisms and particles that are subsequently roved by the mucocilary syst.

Reference: Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440: 497-500(2006)

Function:

View full details