Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Monocyte to macrophage differentiation protein(Mmd)

Recombinant Mouse Monocyte to macrophage differentiation protein(Mmd)

SKU:CSB-CF863431MO

Regular price £1,299.00 GBP
Regular price Sale price £1,299.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CQY7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRFRNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFIRHL

Protein Names:Recommended name: Monocyte to macrophage differentiation protein Alternative name(s): Progestin and adipoQ receptor family member XI

Gene Names:Name:Mmd Synonyms:Paqr11

Expression Region:1-238

Sequence Info:full length protein

View full details