Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Mitochondrial inner membrane organizing system protein 1(Minos1)

Recombinant Mouse Mitochondrial inner membrane organizing system protein 1(Minos1)

SKU:CSB-CF759722MO

Regular price £1,159.00 GBP
Regular price Sale price £1,159.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q7TNS2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSESELGRKWDRCMADTVVKLGTGFGLGIVFSLTFFKRRMWPLAFGSGVGLGMAYSNCQH DFQAPYLLHGKYVKEQ

Protein Names:Recommended name: Mitochondrial inner membrane organizing system protein 1

Gene Names:Name:Minos1

Expression Region:1-76

Sequence Info:full length protein

View full details