Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Membrane-spanning 4-domains subfamily A member 4D(Ms4a4d)

Recombinant Mouse Membrane-spanning 4-domains subfamily A member 4D(Ms4a4d)

SKU:CSB-CF859157MO

Regular price £1,288.00 GBP
Regular price Sale price £1,288.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q99N05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQGLAQTTMAVVPGGAPPSENSVIKSQMWNKNKEKFLKGEPKVLGAIQVMIAFINFSLGI IIILNRVSERFMSVLLLAPFWGSIMFIFSGSLSIAAGVKPTKAMIISSLSVNTISSVLAV AASIIGVISVISGVFRQFRSQPAIASLDVLMTILNMLEFCIAVSVSAFGCKASCCNSSEV LVVLPSNSAVTVTAPPMILQPLPPSECQGKNVPENLYRNQPGEIV

Protein Names:Recommended name: Membrane-spanning 4-domains subfamily A member 4D

Gene Names:Name:Ms4a4d

Expression Region:1-225

Sequence Info:full length protein

View full details