Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Membrane-spanning 4-domains subfamily A member 3(Ms4a3)

Recombinant Mouse Membrane-spanning 4-domains subfamily A member 3(Ms4a3)

SKU:CSB-CF852830MO

Regular price £1,280.00 GBP
Regular price Sale price £1,280.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q920C4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKPEETGGSVYQPLDESRHVQRGVLQALGAIQILNGILILALGIFLVCLQHVSHHFRHFF FFTFYTGYPLWGAVFFISSGSLTVAAGRNPTRMLMQNSFGINIASTTIAFVGTVFLSVHL AFNTQAFKGCQSSPSPDVCISLGSSSDGLVSLMLILTLLELSVTISISAMWCLGNVCGLR EAITSPPNSVESGILPEGSDSENLNTQPQASEE

Protein Names:Recommended name: Membrane-spanning 4-domains subfamily A member 3 Alternative name(s): Hematopoietic-specific transmembrane protein 4 Short name= HTm4

Gene Names:Name:Ms4a3 Synonyms:Htm4

Expression Region:1-213

Sequence Info:full length protein

View full details