Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Matrix metalloproteinase-14(Mmp14)

Recombinant Mouse Matrix metalloproteinase-14(Mmp14)

SKU:CSB-CF014661MO

Regular price £1,529.00 GBP
Regular price Sale price £1,529.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P53690

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV

Protein Names:Recommended name: Matrix metalloproteinase-14 Short name= MMP-14 EC= 3.4.24.80Alternative name(s): MMP-X1 MT-MMP Membrane-type matrix metalloproteinase 1 Short name= MT-MMP 1 Short name= MTMMP1 Membrane-type-1 matrix metalloproteinase Short name= MT1-MMP Short name= MT1MMP

Gene Names:Name:Mmp14Synonyms:Mtmmp

Expression Region:112-582

Sequence Info:full length protein

View full details