Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)

Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)

SKU:CSB-YP317813MO

Regular price £771.00 GBP
Regular price Sale price £771.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P0CW02

Gene Names: Ly6c1

Organism: Mus musculus (Mouse)

AA Sequence: LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG

Expression Region: 27-109aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11.1 kDa

Alternative Name(s):

Relevance:

Reference: "B cells express Ly-6C in a Th1 but not Th2 cytokine environment." Schlueter A.J., Krieg A.M., De Vries P., Li X. J. Interferon Cytokine Res. 22:799-806(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details