
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Cell Biology
Target / Protein: Reg1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P43137
AA Sequence: QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTWADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESGTTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATGSPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVCKFKG
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 22-165aa
Protein length: Full Length of Mature Protein
MW: 32.2 kDa
Alternative Name(s): Islet of Langerhans regenerating protein 1 Short name:REG 1 Pancreatic stone protein 1 Short name:PSP Pancreatic thread protein 1 Short name:PTP Regenerating protein 1
Relevance: Might act as an inhibitor of spontaneous calcium carbonate precipitation.
Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Lithostathine-1(Reg1)
- Regular price
- £542.00 GBP
- Sale price
- £542.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Endothelial cell-specific molecule 1(Esm1)
- Regular price
- £542.00 GBP
- Sale price
- £542.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse RegeneRatingislet-derivedprotein3-gamma(Reg3g)
- Regular price
- £541.00 GBP
- Sale price
- £541.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Chymotrypsin-like elastase family member 3B(Cela3b)
- Regular price
- £542.00 GBP
- Sale price
- £542.00 GBP
- Regular price
-
- Unit price
- per
Sold out