Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse Leukemia inhibitory factor (Lif) (Active)

Recombinant Mouse Leukemia inhibitory factor (Lif) (Active)

SKU:P09056

Regular price £0.00 GBP
Regular price Sale price £0.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Others

Uniprot ID: P09056

Gene Names: LIF

Alternative Name(s): Leukemia Inhibitory Factor; LIF; Differentiation-Stimulating Factor; D Factor; Melanoma-Derived LPL Inhibitor; MLPLI; Emfilermin; LIF; HILDA

Abbreviation: Recombinant Mouse LIF protein (Active)

Organism: Mus musculus (Mouse)

Source: Mammalian cell

Expression Region: 24-203aa

Protein Length: Full Length of Mature Protein

Tag Info: Tag free

Target Protein Sequence: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

MW: 19.9 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: ≤10 EU/mg by the LAL method

Biological_Activity: Measured in the M1 cell differentiation assay. The ED50 is ≤0.2ng/ml.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered solution containing PBS,5%mannitoland0.01% Tween 80, pH7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance:

Reference:

Function:

View full details