Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse L-selectin(Sell)

Recombinant Mouse L-selectin(Sell)

SKU:CSB-CF020977MO

Regular price £1,409.00 GBP
Regular price Sale price £1,409.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P18337

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:WTYHYSEKPMNWENARKFCKQNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMWTWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPGSCNGRGECVETINNHTCICDAGYYGPQCQYVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDCIHPLGNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQETNRSFSKIKEGDYNPLFIPVAVMVTAFSGLAFLIWLARRLKKGKKSQERMDDPY

Protein Names:Recommended name: L-selectin Alternative name(s): CD62 antigen-like family member L Leukocyte adhesion molecule 1 Short name= LAM-1 Leukocyte-endothelial cell adhesion molecule 1 Short name= LECAM1 Lymph node homing receptor Lymphocyte antigen 22 Short name= Ly-22 Lymphocyte surface MEL-14 antigen CD_antigen= CD62L

Gene Names:Name:Sell Synonyms:Lnhr, Ly-22, Ly22

Expression Region:39-372

Sequence Info:full length protein

View full details