Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Interleukin-5 receptor subunit alpha(Il5ra)

Recombinant Mouse Interleukin-5 receptor subunit alpha(Il5ra)

SKU:CSB-CF011663MO

Regular price £1,463.00 GBP
Regular price Sale price £1,463.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P21183

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DLLNHKKFLLLPPVNFTIKATGLAQVLLHWDPNPDQEQRHVDLEYHVKINAPQEDEYDTRKTESKCVTPLHEGFAASVRTILKSSHTTLASSWVSAELKAPPGSPGTSVTNLTCTTHTVVSSHTHLRPYQVSLRCTWLVGKDAPEDTQYFLYYRFGVLTEKCQEYSRDALNRNTACWFPRTFINSKGFEQLAVHINGSSKRAAIKPFDQLFSPLAIDQVNPPRNVTVEIESNSLYIQWEKPLSAFPDHCFNYELKIYNTKNGHIQKEKLIANKFISKIDDVSTYSIQVRAAVSSPCRMPGRWGEWSQPIYVGKERKSLVEWHLIVLPTAACFVLLIFSLICRVCHLWTRLFPPVPAPKSNIKDLPVVTEYEKPSNETKIEVVHCVEEVGFEVMGNSTF

Protein Names:Recommended name: Interleukin-5 receptor subunit alpha Short name= IL-5 receptor subunit alpha Short name= IL-5R subunit alpha Short name= IL-5R-alpha Short name= IL-5RA Alternative name(s): CD_antigen= CD125

Gene Names:Name:Il5ra Synonyms:Il5r

Expression Region:18-415

Sequence Info:full length protein

View full details