Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Interferon-induced transmembrane protein 5(Ifitm5)

Recombinant Mouse Interferon-induced transmembrane protein 5(Ifitm5)

SKU:CSB-CF011028MO-GB

Regular price £1,209.00 GBP
Regular price Sale price £1,209.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O88728

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDTSYPREDPRAPSSRKADAAAHTALSMGTPGPTPRDHMLWSVFSTMYLNLCCLGFLALV HSVKARDQKMAGNLEAARQYGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLSKLAKDS AAFFSTKFDEEDYN

Protein Names:Recommended name: Interferon-induced transmembrane protein 5 Alternative name(s): Bone-restricted interferon-induced transmembrane protein-like protein Short name= Bril Fragilis family member 4

Gene Names:Name:Ifitm5 Synonyms:Bril, Fragilis4

Expression Region:1-134

Sequence Info:Full length protein

View full details