Gene Bio Systems
Recombinant Mouse Interferon gamma(Ifng),partial
Recombinant Mouse Interferon gamma(Ifng),partial
SKU:CSB-RP155874m-GB
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P01580
Gene Names: Ifng
Organism: Mus musculus (Mouse)
AA Sequence: IESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Expression Region: 27-155aa
Sequence Info: partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 19.1 kDa
Alternative Name(s):
Relevance: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Reference: Cloning and expression of murine immune interferon cDNA.Gray P.W., Goeddel D.V.Proc. Natl. Acad. Sci. U.S.A. 80:5842-5846(1983)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
