Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Immediate early response 3-interacting protein 1(Ier3ip1)

Recombinant Mouse Immediate early response 3-interacting protein 1(Ier3ip1)

SKU:CSB-CF887437MO

Regular price £1,165.00 GBP
Regular price Sale price £1,165.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CR20

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVR TVMRVPLIIVNSITIVLLLLFG

Protein Names:Recommended name: Immediate early response 3-interacting protein 1

Gene Names:Name:Ier3ip1

Expression Region:1-82

Sequence Info:full length protein

View full details