Gene Bio Systems
Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit gamma(Fcer1g)
Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit gamma(Fcer1g)
SKU:CSB-CF008533MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P20491
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNTRSQETYETLKHEKPPQ
Protein Names:Recommended name: High affinity immunoglobulin epsilon receptor subunit gamma Alternative name(s): Fc receptor gamma-chain Short name= FcRgamma Fc-epsilon RI-gamma IgE Fc receptor subunit gamma Short name= FceRI gamma
Gene Names:Name:Fcer1g Synonyms:Fce1g
Expression Region:19-86
Sequence Info:full length protein
