Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse High affinity copper uptake protein 1(Slc31a1)

Recombinant Mouse High affinity copper uptake protein 1(Slc31a1)

SKU:CSB-CF814304MO

Regular price £1,262.00 GBP
Regular price Sale price £1,262.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8K211

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNHMGMNHMEMHHHMGMNHTDDNITMPPHHHPTTSASHSHGGGDSMMMMPMTFYFDFKNV NLLFSGLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYNSMPVPGPNGT ILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFL FSWKKAVVVDITEHCH

Protein Names:Recommended name: High affinity copper uptake protein 1 Alternative name(s): Copper transporter 1 Short name= CTR1 Solute carrier family 31 member 1

Gene Names:Name:Slc31a1

Expression Region:1-196

Sequence Info:full length protein

View full details