Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)

Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)

SKU:CSB-YP019135MO

Regular price £758.00 GBP
Regular price Sale price £758.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Neuroscience

Uniprot ID: Q9CYK2

Gene Names: Qpct

Organism: Mus musculus (Mouse)

AA Sequence: AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

Expression Region: 36-362aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 39.6 kDa

Alternative Name(s): Glutaminyl cyclase

Relevance: Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue

Reference: "Developmental expression and subcellular localization of glutaminyl cyclase in mouse brain." Hartlage-Rubsamen M., Staffa K., Waniek A., Wermann M., Hoffmann T., Cynis H., Schilling S., Demuth H.U., Rossner S. Int. J. Dev. Neurosci. 27:825-835(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details