Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Gap junction epsilon-1 protein(Gje1)

Recombinant Mouse Gap junction epsilon-1 protein(Gje1)

SKU:CSB-CF861481MO

Regular price £1,269.00 GBP
Regular price Sale price £1,269.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q9CX92

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLNYIKNFYEGCVKPPTVIGQFHTLFFGSVRMFFLGVLGFAVYGNEALHFSCDPDKREI NLFCYNQFRPITPQVFWALQLVIVLLPGAIFHLYAACKSINQDCILQKPVYTVIYVLSVL LRISLEVFAFWLQIHLFGFQVKPIYLCDTESLGKKPNILKCMVPEHFEKTIFLIAMYTFT VITMVLCVAEVFEIIFRRSCFLFKR

Protein Names:Recommended name: Gap junction epsilon-1 protein Alternative name(s): Connexin-23 Short name= Cx23

Gene Names:Name:Gje1

Expression Region:1-205

Sequence Info:full length protein

View full details