Gene Bio Systems
Recombinant Mouse Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3(B3gat3)
Recombinant Mouse Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3(B3gat3)
SKU:CSB-CF002498MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P58158
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQADLRRPPPVPAQPPEPEALPTIYVITPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAESPTPLVSGLLAASGLLFTHLAVLTPKAQRLREGEPGWVRPRGVEQRNKALDWLRGKGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFKEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPNRPFPLDMAGFAVALPLLLAKPNAQFDATAPRGHLESSLLSHLVDPKDLEPRAANCTQVLVWHTRTEKPKMKQEEQLQRQGQGSDPAIEV
Protein Names:Recommended name: Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 EC= 2.4.1.135 Alternative name(s): Beta-1,3-glucuronyltransferase 3 Glucuronosyltransferase I Short name= GlcAT-I UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase Short name= GlcUAT-I
Gene Names:Name:B3gat3
Expression Region:1-335
Sequence Info:full length protein
