Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3(B3gat3)

Recombinant Mouse Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3(B3gat3)

SKU:CSB-CF002498MO

Regular price £1,390.00 GBP
Regular price Sale price £1,390.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P58158

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQADLRRPPPVPAQPPEPEALPTIYVITPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAESPTPLVSGLLAASGLLFTHLAVLTPKAQRLREGEPGWVRPRGVEQRNKALDWLRGKGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFKEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPNRPFPLDMAGFAVALPLLLAKPNAQFDATAPRGHLESSLLSHLVDPKDLEPRAANCTQVLVWHTRTEKPKMKQEEQLQRQGQGSDPAIEV

Protein Names:Recommended name: Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 EC= 2.4.1.135 Alternative name(s): Beta-1,3-glucuronyltransferase 3 Glucuronosyltransferase I Short name= GlcAT-I UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase Short name= GlcUAT-I

Gene Names:Name:B3gat3

Expression Region:1-335

Sequence Info:full length protein

View full details