Gene Bio Systems
Recombinant Mouse Fms-related tyrosine kinase 3 ligand(Flt3lg)
Recombinant Mouse Fms-related tyrosine kinase 3 ligand(Flt3lg)
SKU:CSB-CF008734MO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:P49772
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:GTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP
Protein Names:Recommended name: Fms-related tyrosine kinase 3 ligand Short name= Flt3 ligand Short name= Flt3L Alternative name(s): SL cytokine
Gene Names:Name:Flt3lg Synonyms:Flt3l
Expression Region:27-232
Sequence Info:full length protein
