Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Fc receptor-like protein 6(Fcrl6)

Recombinant Mouse Fc receptor-like protein 6(Fcrl6)

SKU:CSB-CF008559MO

Regular price £1,338.00 GBP
Regular price Sale price £1,338.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:A1YIY0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QELFPNPELTEFTNSETMDVILKCTIKVDPKNPTLQLFYTFYKNNHVIQDRSPHSVFSAEAKEENSGLYQCMVDTEDGLIQKKSGYLDIQFWTPVSHPVLTLQHEATNLAVGDKVEFLCEAHQGSLPIFYSFYINGEILGKPLAPSGRAASLLASVKAEWSTKNYSCEAKNNISREISELKKFPLVVSGTAWIKSNMLPIWLPASLLGGMVIAAVVLMYFFKPCKKHARPETPTLKEPDSFLYVSVDNQRYK

Protein Names:Recommended name: Fc receptor-like protein 6 Short name= FcR-like protein 6 Short name= FcRL6

Gene Names:Name:Fcrl6

Expression Region:17-268

Sequence Info:full length protein

View full details