Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Epithelial membrane protein 3(Emp3)

Recombinant Mouse Epithelial membrane protein 3(Emp3)

SKU:CSB-CF007650MO

Regular price £1,234.00 GBP
Regular price Sale price £1,234.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:O35912

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLLLLVVSALHILILVLLFVATLDKSWWTLPDKESLNLWYDCTWNTTTQTWACSNVSEN GWLKAVQALMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSAAVFSGALIYAI HTEEILAKHPSGGSFGYCFALAWVAFPLALVSGIVYIHLRKRE

Protein Names:Recommended name: Epithelial membrane protein 3 Short name= EMP-3 Alternative name(s): Hematopoietic neural membrane protein 1 Short name= HNMP-1 Protein YMP

Gene Names:Name:Emp3 Synonyms:Ymp

Expression Region:1-163

Sequence Info:Full length protein

View full details