Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Ephrin-B2(Efnb2)

Recombinant Mouse Ephrin-B2(Efnb2)

SKU:CSB-CF007466MO

Regular price £1,387.00 GBP
Regular price Sale price £1,387.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P52800

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRGGNNNGSEPSDVIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

Protein Names:Recommended name: Ephrin-B2 Alternative name(s): ELF-2 EPH-related receptor tyrosine kinase ligand 5 Short name= LERK-5 HTK ligand Short name= HTK-L

Gene Names:Name:Efnb2 Synonyms:Elf2, Epl5, Eplg5, Htkl, Lerk5

Expression Region:29-336

Sequence Info:full length protein

View full details