Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Elongation of very long chain fatty acids protein 5(Elovl5)

Recombinant Mouse Elongation of very long chain fatty acids protein 5(Elovl5)

SKU:CSB-CF806376MO

Regular price £1,358.00 GBP
Regular price Sale price £1,358.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:Q8BHI7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEHFDASLSTYFKAFLGPRDTRVKGWFLLDNYIPTFVCSVIYLLIVWLGPKYMKNRQPFS CRGILQLYNLGLTLLSLYMFYELVTGVWEGKYNFFCQGTRSAGESDMKIIRVLWWYYFSK LIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLM YSYYGLSSIPSMRPYLWWKKYITQGQLVQFVLTIIQTTCGVFWPCSFPLGWLFFQIGYMI SLIALFTNFYIQTYNKKGASRRKDHLKGHQNGSVAAVNGHTNSFPSLENSVKPRKQRKD

Protein Names:Recommended name: Elongation of very long chain fatty acids protein 5 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase Elovl5 ELOVL fatty acid elongase 5 Short name= ELOVL FA elongase 5

Gene Names:Name:Elovl5

Expression Region:1-299

Sequence Info:full length protein

View full details