GeneBio Systems
Recombinant Mouse Cytochrome P450 3A11 (Cyp3a11)
Recombinant Mouse Cytochrome P450 3A11 (Cyp3a11)
SKU:Q64459
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q64459
Gene Names: Cyp3a11
Alternative Name(s): (CYPIIIA11)(Cytochrome P-450IIIAM1)(Cytochrome P-450UT)
Abbreviation: Recombinant Mouse Cyp3a11 protein
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 1-504aa
Protein Length: Full Length
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Target Protein Sequence: MDLVSALSLETWVLLAISLVLLYRYGTRKHELFKKQGIPGPKPLPFLGTVLNYYKGLWKFDMECYKKYGKTWGLFDGQTPLLAVTDPETIKNVLVKECFSVFTNRRDFGPVGIMSKAISISKDDEWKRYRALLSPTFTSGKLKEMFPVIEQYGDILVKYLRQKAKKGKPVTMKDVLGAYSMDVITSTSFGVNVDSLNNPEDPFVEKAKKLLRFDFFDPLLFSVVLFPFLTPVYEMLNICMFPKDSIEFFKKFVDRMKESRLDSKQKHRVDFLQLMMNSHNNSKDKVSHKALSDMEITAQSIIFIFAGYETTSSTLSFTLHSLATHPDIQKKLQDEIDEALPNKAPPTYDTVMEMEYLDMVLNETLRLYPIANRLERVCKKDVELNGVYIPKGSTVMIPSYALHHDPQHWSEPEEFQPERFSKENKGSIDPYVYLPFGNGPRNCLGMRFALMNMKLALTKIMQNFSFQPCKETQIPLKLSRQGLLQPEKPIVLKVVPRDAVITGA
MW: 65.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: Catalyzes erythromycin N-demethylation, nifedipine oxidation and testosterone 6 beta-hydroxylation.
Reference: "Identification of cytochrome P450 2C2 protein complexes in mouse liver." Li B., Yau P., Kemper B. Proteomics 11: 3359-3368(2011)
Function:
