Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Complement receptor type 2(Cr2),partial

Recombinant Mouse Complement receptor type 2(Cr2),partial

SKU:CSB-EP005934MO(F2)

Regular price £677.00 GBP
Regular price Sale price £677.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P19070

Gene Names: Cr2

Organism: Mus musculus (Mouse)

AA Sequence: ISCDPPPEVKNARKPYYSLPIVPGTVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKGSKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLE

Expression Region: 12-145aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 18.7 kDa

Alternative Name(s): Complement C3d receptor CD_antigen: CD21

Relevance: Receptor for complement C3d. Participates in B lymphocytes activation.

Reference: "Comparative structure and evolution of murine CR2. The homolog of the human C3d/EBV receptor (CD21)."Fingeroth J.D.J. Immunol. 144:3458-3467(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details