GeneBio Systems
Recombinant Mouse Complement C1s-1 subcomponent (C1s1)
Recombinant Mouse Complement C1s-1 subcomponent (C1s1)
SKU:Q8CG14
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: Q8CG14
Gene Names: C1s1
Alternative Name(s): (C1 esterase)(Complement component 1 subcomponent s-A)
Abbreviation: Recombinant Mouse C1s1 protein
Organism: Mus musculus (Mouse)
Source: E.coli
Expression Region: 16-688aa
Protein Length: Full Length of Mature Protein
Tag Info: C-terminal 6xHis-tagged
Target Protein Sequence: EPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYFTHVDIEPSESCAYDSVQIISGGIEEGRLCGQKTSKSPNSPIIEEFQFPYNKLQVVFTSDFSNEERFTGFAAYYTAIDINECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVNCSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNCPDSLTFASKNQQFGPYCGNGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDPISCAKKITANSTWEPDKAKYVFKDVVKITCVDGFEVVEGHVSSTSYYSTCQSDGQWSNSGLKCQPVYCGIPDPIANGKVEEPENSVFGTVVHYTCEEPYYYMEHEEGGEYRCAANGRWVNDQLGIELPRCIPACGVPTEPFQVHQRIFGGQPAKIENFPWQVFFNHPRASGALINEYWVLTAAHVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQLKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLETCKQVKEENPTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVSWGKRCGTYGVYTKVKNYVDWILKTMQENSGPRKD
MW: 77.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance: C1s B chain is a serine protease that combines with C1q and C1r to form C1, the first component of the classical pathway of the complement system. C1r activates C1s so that it can, in turn, activate C2 and C4.
Reference: "Complement C1r and C1s genes are duplicated in the mouse: differential expression generates alternative isomorphs in the liver and in the male reproductive system." Garnier G., Circolo A., Xu Y., Volanakis J.E. Biochem. J. 371: 631-640(2003)
Function:
