Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3)

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3(C1qtnf3)

SKU:CSB-EP875360MO

Regular price £797.00 GBP
Regular price Sale price £797.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Metabolism

Uniprot ID: Q9ES30

Gene Names: C1qtnf3

Organism: Mus musculus (Mouse)

AA Sequence: QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Expression Region: 23-246aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 31.1 kDa

Alternative Name(s): Collagenous repeat-containing sequence 26 kDa protein Short name:CORS26 Secretory protein CORS26 Ctrp3

Relevance:

Reference: "Role of specificity protein-1, PPARgamma, and pituitary protein transcription factor-1 in transcriptional regulation of the murine CORS-26 promoter." Schaffler A., Ehling A., Neumann E., Herfarth H., Paul G., Tarner I., Gay S., Buechler C., Scholmerich J., Muller-Ladner U. Biochim. Biophys. Acta 1678:150-156(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details