Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse CMRF35-like molecule 6(Cd300c)

Recombinant Mouse CMRF35-like molecule 6(Cd300c)

SKU:CSB-CF004917MO

Regular price £1,297.00 GBP
Regular price Sale price £1,297.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:A2A7V7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HFPVRGPSTVTGTVGESLSVSCQYEKKLKTKKKIWCKWKSNVLCKDIVKTSASEEARNGRVSIRDHPDNLTFTVTLENLTLEDAGTYMCMVDIGFFYDAYLQIDKSFKVEVFVVPGKPPFKGSRPGNGINILASPTSSAVHTQPNVTTDDTIPAPSPELRSLLSSPHFWILVSLKLPLFLSMLGALLWVNRPQRCSGGSSAWPCYENQ

Protein Names:Recommended name: CMRF35-like molecule 6 Short name= CLM-6 Alternative name(s): CD300 antigen-like family member C CD_antigen= CD300c

Gene Names:Name:Cd300c Synonyms:Clm6

Expression Region:22-229

Sequence Info:full length protein

View full details