Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase(St3gal3)

Recombinant Mouse CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase(St3gal3)

SKU:CSB-CF022753MO

Regular price £1,423.00 GBP
Regular price Sale price £1,423.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:P97325

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEDSNSLLLSLDSAGQTLGTEYDRLGFLLKLDSKLPAELATKYANFSEGACKPGYASAMMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLHCRRCIIVGNGGVLANKSLGSRIDDYDIVIRLNSAPVKGFERDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMNTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Protein Names:Recommended name: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase EC= 2.4.99.6 Alternative name(s): Beta-galactoside alpha-2,3-sialyltransferase 3 Short name= Alpha 2,3-ST 3 Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase N-acetyllactosaminide alpha-2,3-sialyltransferase ST3Gal III Short name= ST3GalIII ST3N Sialyltransferase 6

Gene Names:Name:St3gal3 Synonyms:Siat3, Siat6

Expression Region:1-374

Sequence Info:full length protein

View full details