
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mus musculus (Mouse)
Uniprot NO.:Q8BIG7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQPVPRLSIPAALALGSAALGAAFATGLLLGKRWPPWGSRRQERLLPPEDNPLWQYLLS RSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIKAKKALDLGTFTGYSALAL ALALPEAGRVVTCEVDAEPPKLGRPMWKQAEVEQKIDLRLQPALQTLDELLAAGEAGTFD IAVVDADKENCTAYYERCLQLLRPGGVLAVLRVLWRGEVLQPQPRNKTVECVRNLNERIL RDARVYISLLPLDDGLSLAFKI
Protein Names:Recommended name: Catechol O-methyltransferase domain-containing protein 1 EC= 2.1.1.-
Gene Names:Name:Comtd1
Expression Region:1-262
Sequence Info:full length protein
You may also like
-
Recombinant Mouse Catechol O-methyltransferase(Comt)
- Regular price
- £957.00 GBP
- Sale price
- £957.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Catechol O-methyltransferase domain-containing protein 1(COMTD1)
- Regular price
- £955.00 GBP
- Sale price
- £955.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Catechol O-methyltransferase(Comt)
- Regular price
- £956.00 GBP
- Sale price
- £956.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine Catechol O-methyltransferase(COMT)
- Regular price
- £961.00 GBP
- Sale price
- £961.00 GBP
- Regular price
-
- Unit price
- per
Sold out