
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cancer
Uniprot ID:O08736
Gene Names:Casp12
Organism:Mus musculus (Mouse)
AA Sequence:MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDE
Expression Region:1-92aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 6xHis-B2M-tagged
MW:24.3 kDa
Alternative Name(s):Caspase-12(CASP-12)(EC 3.4.22.-)
Relevance:Involved in the activation cascade of caspases responsible for apoptosis execution.
Reference:"Activation of caspase-12, an endoplastic reticulum (ER) resident caspase, through tumor necrosis factor receptor-associated factor 2-dependent mechanism in response to the ER stress." Yoneda T., Imaizumi K., Oono K., Yui D., Gomi F., Katayama T., Tohyama M. J. Biol. Chem. 276:13935-13940(2001)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:13-23 business days
You may also like
-
Recombinant Mouse Lymphocyte antigen 6K(Ly6k)
- Regular price
- £700.00 GBP
- Sale price
- £700.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Lymphocyte antigen 6A-2/6E-1(Ly6a)
- Regular price
- £625.00 GBP
- Sale price
- £625.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Protein canopy homolog 2(Cnpy2)
- Regular price
- £625.00 GBP
- Sale price
- £625.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Cystatin-C(Cst3)
- Regular price
- £451.00 GBP
- Sale price
- £451.00 GBP
- Regular price
-
- Unit price
- per
Sold out