Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Calcium-dependent phospholipase A2(Pla2g5)

Recombinant Mouse Calcium-dependent phospholipase A2(Pla2g5)

SKU:CSB-EP018103MO

Regular price £679.00 GBP
Regular price Sale price £679.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P97391

Gene Names: Pla2g5

Organism: Mus musculus (Mouse)

AA Sequence: GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC

Expression Region: 21-137aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 29.8 kDa

Alternative Name(s): Group V phospholipase A2;PLA2-10Phosphatidylcholine 2-acylhydrolase 5

Relevance: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes L-alpha-palmitoyl-2-oleoyl phosphatidylcholine more efficiently than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol .

Reference: Low-molecular-weight, calcium-dependent phospholipase A2 genes are linked and map to homologous chromosome regions in mouse and human.Tischfield J.A., Xia Y.R., Shih D.M., Klisak I., Chen J., Engle S.J., Siakotos A.N., Winstead M.V., Seilhamer J.J., Allamand V., Gyapay G., Lusis A.Genomics 32:328-333(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details