Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse C-X-C chemokine receptor type 3(Cxcr3),partial

Recombinant Mouse C-X-C chemokine receptor type 3(Cxcr3),partial

SKU:CSB-EP006253MO1

Regular price £696.00 GBP
Regular price Sale price £696.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:O88410

Gene Names:Cxcr3

Organism:Mus musculus(Mouse)

AA Sequence:MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR

Expression Region:1-52aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 6xHis-KSI-tagged

MW:21.3 kDa

Alternative Name(s):Interferon-inducible protein 10 receptor (IP-10 receptor) (CD_antigen: CD183) (CXC-R3) (CXCR-3) (Cmkar3)

Relevance:Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response.

Reference:"Cloning of the murine interferon-inducible protein 10 (IP-10) receptor and its specific expression in lymphoid organs." Tamaru M., Tominaga Y., Yatunami K., Narumi S. Biochem. Biophys. Res. Commun. 251:41-48(1998)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details