Skip to product information
1 of 1

GeneBio Systems

Recombinant Mouse C-C motif chemokine 3 (Ccl3)

Recombinant Mouse C-C motif chemokine 3 (Ccl3)

SKU:P10855

Regular price £583.00 GBP
Regular price Sale price £583.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P10855

Gene Names: Ccl3

Alternative Name(s): Heparin-binding chemotaxis protein;L2G25BMacrophage inflammatory protein 1-alpha ;MIP-1-alpha;SIS-alpha;Small-inducible cytokine A3TY-5

Abbreviation: Recombinant Mouse Ccl3 protein

Organism: Mus musculus (Mouse)

Source: E.coli

Expression Region: 24-92aa

Protein Length: Full Length of Mature Protein

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA

MW: 12.0 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Monokine with inflammatory, pyrogenic and chokinetic properties. Has a potent chotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.

Reference: Macrophages secrete a novel heparin-binding protein with inflammatory and neutrophil chemokinetic properties.Wolpe S.D., Davatelis G., Sherry B., Beutler B., Hesse D.G., Nguyen H.T., Moldawer L.L., Nathan C.F., Lowry S.F., Cerami A.J. Exp. Med. 167: 570-581(1988)

Function: Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.

View full details