Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Beta-defensin 1(Defb1)

Recombinant Mouse Beta-defensin 1(Defb1)

SKU:CSB-EP006662MO

Regular price £872.00 GBP
Regular price Sale price £872.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P56386

Gene Names: Defb1

Organism: Mus musculus (Mouse)

AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS

Expression Region: 33-69aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 20.1 kDa

Alternative Name(s): Short name:BD-1 Short name:mBD-1

Relevance: Has bactericidal activity.

Reference: "The mouse genome encodes a single homolog of the antimicrobial peptide human beta-defensin 1."Huttner K.M., Kozak C.A., Bevins C.L.FEBS Lett. 413:45-49(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details