Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mouse Beta-defensin 14(Defb14)

Recombinant Mouse Beta-defensin 14(Defb14)

SKU:CSB-EP749254MO

Regular price £743.00 GBP
Regular price Sale price £743.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q7TNV9

Gene Names: Defb14

Organism: Mus musculus (Mouse)

AA Sequence: FLPKTLRKFFCRIRGGRCAVLNCLGKEEQIGRCSNSGRKCCRKKK

Expression Region: 23-67aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 21.2 kDa

Alternative Name(s): Defensin, beta 14

Relevance: Has antibacterial activity.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details